Recombinant Human Serotransferrin (TF) , Active Protein, Unconjugated, Mammal

Catalog Number: BIM-RPC30555
Article Name: Recombinant Human Serotransferrin (TF) , Active Protein, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC30555
Supplier Catalog Number: RPC30555
Alternative Catalog Number: BIM-RPC30555-100UG,BIM-RPC30555-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Transferrin, Beta-1 metal-binding globulin, Siderophilin, TF, PRO1400
Accession Number: P02787; TF. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 20-698aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Serotransferrin (TF) , Active Protein is a purified Active Recombinant Protein
Molecular Weight: 104.1kDa
Tag: C-Terminal hFc-Tagged
Purity: >95% by SDS-PAGE
Sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVAR
Target: Serotransferrin (TF)