Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein, Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein, Unconjugated, Yeast
• Artikelnummer: BIM-RPC30566
• Hersteller Artikelnummer: RPC30566
• Alternativnummer: BIM-RPC30566-20UG,BIM-RPC30566-100UG,BIM-RPC30566-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: 20 kDa myosin light chain, LC20, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1

Produktbeschreibung

Accession Number: P24844; MYL9. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 2-172aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein is a purified Active Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 21.7kDa
• Tag: C-Terminal 10xHis-Tagged
• Reinheit: >95% by SDS-PAGE
• Sequenz: SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
• Target-Kategorie: Myosin regulatory light polypeptide 9 (MYL9)