Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein, Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein, Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC30566
• Supplier Catalog Number: RPC30566
• Alternative Catalog Number: BIM-RPC30566-20UG,BIM-RPC30566-100UG,BIM-RPC30566-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: 20 kDa myosin light chain, LC20, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1

Product Description

Accession Number: P24844; MYL9. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 2-172aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) , Active Protein is a purified Active Recombinant Protein

Product Properties

• Molecular Weight: 21.7kDa
• Tag: C-Terminal 10xHis-Tagged
• Purity: >95% by SDS-PAGE
• Sequence: SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
• Target: Myosin regulatory light polypeptide 9 (MYL9)