Recombinant Human Pulmonary surfactant-associated protein C (SFTPC), Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Human Pulmonary surfactant-associated protein C (SFTPC), Unconjugated, Yeast
• Artikelnummer: BIM-RPC30571
• Hersteller Artikelnummer: RPC30571
• Alternativnummer: BIM-RPC30571-20UG,BIM-RPC30571-100UG,BIM-RPC30571-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Pulmonary surfactant-associated proteolipid SPL(Val) SP5

Produktbeschreibung

Accession Number: P11686; SFTPC. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24-58aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Transport. Shipping Condition: Ice packs. Short Description: Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 5.7kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
• Target-Kategorie: Pulmonary surfactant-associated protein C (SFTPC)