Recombinant Human Pulmonary surfactant-associated protein C (SFTPC), Unconjugated, Yeast

Product Overview

• Article Name: Recombinant Human Pulmonary surfactant-associated protein C (SFTPC), Unconjugated, Yeast
• Biozol Catalog Number: BIM-RPC30571
• Supplier Catalog Number: RPC30571
• Alternative Catalog Number: BIM-RPC30571-20UG,BIM-RPC30571-100UG,BIM-RPC30571-1MG
• Manufacturer: Biomatik Corporation
• Host: Yeast
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Pulmonary surfactant-associated proteolipid SPL(Val) SP5

Product Description

Accession Number: P11686; SFTPC. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24-58aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Transport. Shipping Condition: Ice packs. Short Description: Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 5.7kDa
• Tag: N-Terminal 6xHis-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
• Target: Pulmonary surfactant-associated protein C (SFTPC)