Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC31358
• Hersteller Artikelnummer: RPC31358
• Alternativnummer: BIM-RPC31358-20UG,BIM-RPC31358-100UG,BIM-RPC31358-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Hepatitis C virus NS5A-transactivated protein 4, HCV NS5A-transactivated protein 4, Protein NICE-3, S863-3

Produktbeschreibung

Accession Number: Q9BWL3; C1orf43. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 32-253aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human Protein C1orf43 (C1orf43), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 32.9kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
• Target-Kategorie: Protein C1orf43 (C1orf43)