Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC31358
• Supplier Catalog Number: RPC31358
• Alternative Catalog Number: BIM-RPC31358-20UG,BIM-RPC31358-100UG,BIM-RPC31358-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Hepatitis C virus NS5A-transactivated protein 4, HCV NS5A-transactivated protein 4, Protein NICE-3, S863-3

Product Description

Recombinant Human Protein C1orf43 (C1orf43), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Protein C1orf43 (C1orf43) . Accession Number: Q9BWL3, C1orf43. Expression Region: 32-253aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.9kda. Target Synonyms: Hepatitis C virus NS5A-transactivated protein 4, HCV NS5A-transactivated protein 4, Protein NICE-3, S863-3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 32.9kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
• Target: Protein C1orf43 (C1orf43)