Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Protein C1orf43 (C1orf43), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC31358
• Supplier Catalog Number: RPC31358
• Alternative Catalog Number: BIM-RPC31358-20UG,BIM-RPC31358-100UG,BIM-RPC31358-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Hepatitis C virus NS5A-transactivated protein 4, HCV NS5A-transactivated protein 4, Protein NICE-3, S863-3

Product Description

Accession Number: Q9BWL3; C1orf43. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 32-253aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human Protein C1orf43 (C1orf43), partial is a purified Recombinant Protein

Product Properties

• Molecular Weight: 32.9kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Purity: >90% by SDS-PAGE
• Sequence: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
• Target: Protein C1orf43 (C1orf43)