Anti Growth Differentiation Factor 9, IgG1, Clone: [53/1], Mouse

Artikelnummer: BIS-53/1-100UG
Artikelname: Anti Growth Differentiation Factor 9, IgG1, Clone: [53/1], Mouse
Artikelnummer: BIS-53/1-100UG
Hersteller Artikelnummer: 53/1-100µg
Alternativnummer: BIS-53/1-100UG
Hersteller: BioServUK
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ELISA, IHC, WB
Spezies Reaktivität: Human
Immunogen: Tubercµlin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Anti Growth Differentiation Factor 9 (Clone: 53/1)
Klonalität: Monoclonal
Klon-Bezeichnung: [53/1]
Isotyp: IgG1
Reinheit: Available as purified IgG or supernatant