Anti Growth Differentiation Factor 9, IgG1, Clone: [53/1], Mouse, Monoclonal

Catalog Number: BIS-53/1-100UG
Article Name: Anti Growth Differentiation Factor 9, IgG1, Clone: [53/1], Mouse, Monoclonal
Biozol Catalog Number: BIS-53/1-100UG
Supplier Catalog Number: 53/1-100µg
Alternative Catalog Number: BIS-53/1-100UG
Manufacturer: BioServUK
Host: Mouse
Category: Sonstiges
Application: ELISA, IHC, WB
Species Reactivity: Human
Immunogen: Tubercµlin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Anti Growth Differentiation Factor 9 (Clone: 53/1)
Clonality: Monoclonal
Clone Designation: [53/1]
Isotype: IgG1
Purity: Available as purified IgG or supernatant