Anti-SARS-CoV-2 ORF8 Antibody, Cy3, Rabbit, Polyclonal

Artikelnummer: BOB-A33995-CY3
Artikelname: Anti-SARS-CoV-2 ORF8 Antibody, Cy3, Rabbit, Polyclonal
Artikelnummer: BOB-A33995-CY3
Hersteller Artikelnummer: A33995-Cy3
Alternativnummer: BOB-A33995-CY3-100UG
Hersteller: Boster Bio
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Konjugation: Cy3
Alternative Synonym: ORF8 protein, ORF8, Non-structural protein 8, ns8
Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog A33995. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTC8
Puffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Reinheit: Immunogen affinity purified.
Formulierung: Lyophilized
Application Verdünnung: ELISA, 0.001-0.1µg/ml, Human