Anti-SARS-CoV-2 ORF8 Antibody Cy3 Conjugated, Rabbit, Polyclonal
Catalog Number:
BOB-A33995-CY3
| Article Name: |
Anti-SARS-CoV-2 ORF8 Antibody Cy3 Conjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BOB-A33995-CY3 |
| Supplier Catalog Number: |
A33995-Cy3 |
| Alternative Catalog Number: |
BOB-A33995-CY3-100UG,BOB-A33995-CY3-100UG/VIAL |
| Manufacturer: |
Boster Bio |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
FC |
| Species Reactivity: |
Human |
| Immunogen: |
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Conjugation: |
Cy3 |
| Alternative Names: |
ORF8 protein, ORF8, Non-structural protein 8, ns8 |
| Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog A33995. Tested in ELISA applications. This antibody reacts with Human. |
| Clonality: |
Polyclonal |
| Concentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molecular Weight: |
Calculated Molecular Weight: 16693 MW |
| NCBI: |
43740577 |
| UniProt: |
P0DTC8 |
| Buffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Purity: |
Immunogen affinity purified. |
| Form: |
Liquid |
| Application Dilute: |
Flow Cytometry, 1-3µg/1x106 cells |
