Anti-SARS-CoV-2 ORF8 Antibody FITC Conjugated, Rabbit, Polyclonal
Artikelnummer:
BOB-A33995-FITC
| Artikelname: |
Anti-SARS-CoV-2 ORF8 Antibody FITC Conjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BOB-A33995-FITC |
| Hersteller Artikelnummer: |
A33995-FITC |
| Alternativnummer: |
BOB-A33995-FITC-100UG,BOB-A33995-FITC-100UG/VIAL |
| Hersteller: |
Boster Bio |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
FC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Konjugation: |
FITC |
| Alternative Synonym: |
ORF8 protein, ORF8, Non-structural protein 8, ns8 |
| Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog A33995. Tested in ELISA applications. This antibody reacts with Human. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molekulargewicht: |
Calculated Molecular Weight: 16693 MW |
| NCBI: |
43740577 |
| UniProt: |
P0DTC8 |
| Puffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Reinheit: |
Immunogen affinity purified. |
| Formulierung: |
Liquid |
| Application Verdünnung: |
Flow Cytometry, 1-3µg/1x106 cells |
