Anti-SARS-CoV-2 ORF8 Antibody, FITC, Rabbit, Polyclonal

Catalog Number: BOB-A33995-FITC
Article Name: Anti-SARS-CoV-2 ORF8 Antibody, FITC, Rabbit, Polyclonal
Biozol Catalog Number: BOB-A33995-FITC
Supplier Catalog Number: A33995-FITC
Alternative Catalog Number: BOB-A33995-FITC-100UG
Manufacturer: Boster Bio
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Conjugation: FITC
Alternative Names: ORF8 protein, ORF8, Non-structural protein 8, ns8
Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog A33995. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTC8
Buffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Purity: Immunogen affinity purified.
Form: Lyophilized
Application Dilute: ELISA, 0.001-0.1µg/ml, Human