Mouse recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Artikelnummer: BOB-PROTP04202-2-5UG
Artikelname: Mouse recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
Artikelnummer: BOB-PROTP04202-2-5UG
Hersteller Artikelnummer: PROTP04202-2-5ug
Alternativnummer: BOB-PROTP04202-2-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: Differentiation inhibiting factor, Cartilage-inducing factor, Tgfb-1
The transforming Growth Factors beta (TGF beta) family of cytokines are ubiquitous, multifunctional, and essential to survival. They play the central roles in growth, development, inflammation, repair, and host immunity. The mammalian TGF beta isoforms (TGF beta 1, beta 2 and beta 3) are secreted as potential precursors and possess a variety of cell surface receptors and produces at least two mediate signal transductions.
Molekulargewicht: The protein has a calculated MW of 13.8 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P04202
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequenz: MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.