Mouse recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

Catalog Number: BOB-PROTP04202-2-5UG
Article Name: Mouse recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF
Biozol Catalog Number: BOB-PROTP04202-2-5UG
Supplier Catalog Number: PROTP04202-2-5ug
Alternative Catalog Number: BOB-PROTP04202-2-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: Differentiation inhibiting factor, Cartilage-inducing factor, Tgfb-1
The transforming Growth Factors beta (TGF beta) family of cytokines are ubiquitous, multifunctional, and essential to survival. They play the central roles in growth, development, inflammation, repair, and host immunity. The mammalian TGF beta isoforms (TGF beta 1, beta 2 and beta 3) are secreted as potential precursors and possess a variety of cell surface receptors and produces at least two mediate signal transductions.
Molecular Weight: The protein has a calculated MW of 13.8 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P04202
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.