Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Artikelnummer: BOB-PROTP16545-5UG
Artikelname: Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF
Artikelnummer: BOB-PROTP16545-5UG
Hersteller Artikelnummer: PROTP16545-5ug
Alternativnummer: BOB-PROTP16545-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Porcine
Alternative Synonym: IGF-1, Npt2B
Insulin Like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.
Molekulargewicht: The protein has a calculated MW of 8.59 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P16545
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.