Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Product Overview

• Article Name: Swine recombinant IGF-I (Insulin-like growth factor-I) protein, AF
• Biozol Catalog Number: BOB-PROTP16545-5UG
• Supplier Catalog Number: PROTP16545-5ug
• Alternative Catalog Number: BOB-PROTP16545-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Porcine
• Alternative Names: IGF-1, Npt2B

Product Description

Insulin Like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Product Properties

• Molecular Weight: The protein has a calculated MW of 8.59 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P16545
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.