Swine recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF

Artikelnummer: BOB-PROTP18430-1-5UG
Artikelname: Swine recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF
Artikelnummer: BOB-PROTP18430-1-5UG
Hersteller Artikelnummer: PROTP18430-1-5ug
Alternativnummer: BOB-PROTP18430-1-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Porcine
Alternative Synonym: IL1A
Interleukin 1-alpha (IL-1alpha), also named hematopoietin 1, is a 17.65 kDa cytokine with 159 amino acid residues. IL-1alpha is mainly expressed in macrophages, neutrophils, epithelial cells, and endothelial cells. When IL-1alpha binds to the IL-1 receptor, It mediates a wide variety of biological processes such as cell division, angiogenesis, production of interleukin-2, and cellular sodium ion homeostasis. In addition, IL-1alpha also plays a critical role in immune responses, such as fever and inflammation, and triggers tumor necrosis factor-alpha.
Molekulargewicht: The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P18430
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS with polyhistidine tag at the C-terminus.