Swine recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF

Product Overview

• Article Name: Swine recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF
• Biozol Catalog Number: BOB-PROTP18430-1-5UG
• Supplier Catalog Number: PROTP18430-1-5ug
• Alternative Catalog Number: BOB-PROTP18430-1-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Porcine
• Alternative Names: IL1A

Product Description

Interleukin 1-alpha (IL-1alpha), also named hematopoietin 1, is a 17.65 kDa cytokine with 159 amino acid residues. IL-1alpha is mainly expressed in macrophages, neutrophils, epithelial cells, and endothelial cells. When IL-1alpha binds to the IL-1 receptor, It mediates a wide variety of biological processes such as cell division, angiogenesis, production of interleukin-2, and cellular sodium ion homeostasis. In addition, IL-1alpha also plays a critical role in immune responses, such as fever and inflammation, and triggers tumor necrosis factor-alpha.

Product Properties

• Molecular Weight: The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P18430
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS with polyhistidine tag at the C-terminus.