Human recombinant Pleiotrophin protein, AF

Artikelnummer: BOB-PROTP21246-3-5UG
Artikelname: Human recombinant Pleiotrophin protein, AF
Artikelnummer: BOB-PROTP21246-3-5UG
Hersteller Artikelnummer: PROTP21246-3-5ug
Alternativnummer: BOB-PROTP21246-3-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: PTN, Heparin Affin Regulatory Protein (HARP), Heparin-Binding Growth Factor-8 (HBGF-8), Osteoblast-Specific Factor 1 (OSF-1)
Pleiotrophin (PTN) also known as HB-GAM, which is a Growth Factors involves in widely range of biological events such as bone development, neural regeneration, inflammatory response, tissue repair. PTN is 18.9 kDa protein containing 168 residues that expressed in Osteoblast and brain. Besides, PTN has been revealed to suppress the long-term potentiation (LTP) in hippocampus and plays a critical role in modulating learning-related behavior. On the other hand, PTN also acts as an angiogenic factor that promotes tumor progression by PTN/Anaplastic Lymphoma Kinase (ALK) axis.
Molekulargewicht: The protein has a calculated MW of 19.89 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P21246
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.