Human recombinant Pleiotrophin protein, AF

Catalog Number: BOB-PROTP21246-3-5UG
Article Name: Human recombinant Pleiotrophin protein, AF
Biozol Catalog Number: BOB-PROTP21246-3-5UG
Supplier Catalog Number: PROTP21246-3-5ug
Alternative Catalog Number: BOB-PROTP21246-3-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: PTN, Heparin Affin Regulatory Protein (HARP), Heparin-Binding Growth Factor-8 (HBGF-8), Osteoblast-Specific Factor 1 (OSF-1)
Pleiotrophin (PTN) also known as HB-GAM, which is a Growth Factors involves in widely range of biological events such as bone development, neural regeneration, inflammatory response, tissue repair. PTN is 18.9 kDa protein containing 168 residues that expressed in Osteoblast and brain. Besides, PTN has been revealed to suppress the long-term potentiation (LTP) in hippocampus and plays a critical role in modulating learning-related behavior. On the other hand, PTN also acts as an angiogenic factor that promotes tumor progression by PTN/Anaplastic Lymphoma Kinase (ALK) axis.
Molecular Weight: The protein has a calculated MW of 19.89 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P21246
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.