Swine recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

Artikelnummer: BOB-PROTQ5S1S3-5UG
Artikelname: Swine recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF
Artikelnummer: BOB-PROTQ5S1S3-5UG
Hersteller Artikelnummer: PROTQ5S1S3-5ug
Alternativnummer: BOB-PROTQ5S1S3-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Porcine
C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 9.1kDa protein containing 82 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNgamma. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the the cell migration and activation like T cells and dendritic cells
Molekulargewicht: The protein has a calculated MW of 10.13 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: Q5S1S3
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA with polyhistidine tag at the N-terminus.