Swine recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

Product Overview

• Article Name: Swine recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF
• Biozol Catalog Number: BOB-PROTQ5S1S3-5UG
• Supplier Catalog Number: PROTQ5S1S3-5ug
• Alternative Catalog Number: BOB-PROTQ5S1S3-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Porcine

Product Description

C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 9.1kDa protein containing 82 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNgamma. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induce the the cell migration and activation like T cells and dendritic cells

Product Properties

• Molecular Weight: The protein has a calculated MW of 10.13 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (N-term)
• UniProt: Q5S1S3
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA with polyhistidine tag at the N-terminus.