Human recombinant IL-17F (Interleukin-17F) protein, AF

Artikelnummer: BOB-PROTQ96PD4-7-100UG
Artikelname: Human recombinant IL-17F (Interleukin-17F) protein, AF
Artikelnummer: BOB-PROTQ96PD4-7-100UG
Hersteller Artikelnummer: PROTQ96PD4-7-100ug
Alternativnummer: BOB-PROTQ96PD4-7-100UG-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: CANDF6, IL-17F, ML-1, ML1
Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. It is involved in the development of inflammation and host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family.
Molekulargewicht: The protein has a calculated MW of 15.84 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q96PD4
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium acetate, pH 4.0. If you have any concerns or special requirements, please confirm with us.
Sequenz: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ with polyhistidine tag at the C-terminus.