Human recombinant IL-17F (Interleukin-17F) protein, AF

Product Overview

• Article Name: Human recombinant IL-17F (Interleukin-17F) protein, AF
• Biozol Catalog Number: BOB-PROTQ96PD4-7-100UG
• Supplier Catalog Number: PROTQ96PD4-7-100ug
• Alternative Catalog Number: BOB-PROTQ96PD4-7-100UG-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: CANDF6, IL-17F, ML-1, ML1

Product Description

Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. It is involved in the development of inflammation and host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family.

Product Properties

• Molecular Weight: The protein has a calculated MW of 15.84 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q96PD4
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium acetate, pH 4.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ with polyhistidine tag at the C-terminus.