Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

Artikelnummer: BOB-PROTQ99062-3-5UG
Artikelname: Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
Artikelnummer: BOB-PROTQ99062-3-5UG
Hersteller Artikelnummer: PROTQ99062-3-5ug
Alternativnummer: BOB-PROTQ99062-3-5UG-5UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: CSF-3, MGI-1G, GM-CSF beta, pluripoietin
Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment also is an established useful clinical agent for increasing neutrophilic granulocytes levels. G-CSF is a 18.67 kDa protein having 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, development of myeloid cells.
Molekulargewicht: The protein has a calculated MW of 19.48 kDa. The protein migrates as 21kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: Q99062
Quelle: Escherichia coli
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.