Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF

Product Overview

• Article Name: Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
• Biozol Catalog Number: BOB-PROTQ99062-3-5UG
• Supplier Catalog Number: PROTQ99062-3-5ug
• Alternative Catalog Number: BOB-PROTQ99062-3-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: CSF-3, MGI-1G, GM-CSF beta, pluripoietin

Product Description

Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment also is an established useful clinical agent for increasing neutrophilic granulocytes levels. G-CSF is a 18.67 kDa protein having 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, development of myeloid cells.

Product Properties

• Molecular Weight: The protein has a calculated MW of 19.48 kDa. The protein migrates as 21kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (N-term)
• UniProt: Q99062
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.