RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)

Artikelnummer: BWT-BK0270
Artikelname: RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)
Artikelnummer: BWT-BK0270
Hersteller Artikelnummer: BK0270
Alternativnummer: BWT-BK0270-10UG,BWT-BK0270-1MG,BWT-BK0270-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection.
Molekulargewicht: 8-10 kDa, observed by reducing SDS-PAGE.
Quelle: CHO
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.