RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)

Catalog Number: BWT-BK0270
Article Name: RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)
Biozol Catalog Number: BWT-BK0270
Supplier Catalog Number: BK0270
Alternative Catalog Number: BWT-BK0270-10UG,BWT-BK0270-1MG,BWT-BK0270-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the trafficking and activation of inflammatory cells, such as macrophages, lymphocytes, NK cells and dendritic cells. MIP-1 alpha polymorphisms are associated with HIV susceptibility or resistance. Recombinant MIP-1 alpha induces a dose-dependent inhibition of HIV and SIV infection.
Molecular Weight: 8-10 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.