RecombinantIGF-BP-2,His,Human

Artikelnummer: BWT-BK0308
Artikelname: RecombinantIGF-BP-2,His,Human
Artikelnummer: BWT-BK0308
Hersteller Artikelnummer: BK0308
Alternativnummer: BWT-BK0308-10UG,BWT-BK0308-1MG,BWT-BK0308-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
IGF-BP-2,also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.
Molekulargewicht: 6-20 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTG
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.