RecombinantPF-4/CXCL4,Human

Artikelnummer: BWT-BK0328
Artikelname: RecombinantPF-4/CXCL4,Human
Artikelnummer: BWT-BK0328
Hersteller Artikelnummer: BK0328
Alternativnummer: BWT-BK0328-10UG,BWT-BK0328-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the alpha-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.
Molekulargewicht: ~7.8 kDa, observed by non-reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.