RecombinantPF-4/CXCL4,Human

Catalog Number: BWT-BK0328
Article Name: RecombinantPF-4/CXCL4,Human
Biozol Catalog Number: BWT-BK0328
Supplier Catalog Number: BK0328
Alternative Catalog Number: BWT-BK0328-10UG,BWT-BK0328-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the alpha-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.
Molecular Weight: ~7.8 kDa, observed by non-reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.