CD58 Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0323
Artikelname: CD58 Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0323
Hersteller Artikelnummer: NCP0323
Alternativnummer: BWT-NCP0323-500UG,BWT-NCP0323-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.
Molekulargewicht: ~24kDa
Tag: His-tag
UniProt: P19256
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR