CD58 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0323
Article Name: CD58 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0323
Supplier Catalog Number: NCP0323
Alternative Catalog Number: BWT-NCP0323-500UG,BWT-NCP0323-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.
Molecular Weight: ~24kDa
Tag: His-tag
UniProt: P19256
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR