CD265 Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0359
Artikelname: CD265 Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0359
Hersteller Artikelnummer: NCP0359
Alternativnummer: BWT-NCP0359-500UG,BWT-NCP0359-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
RANK (receptor activator of NF-kappaB) is a member of the tumor necrosis factor (TNF) receptor subfamily that is activated by its ligand, RANKL (TRANCE/OPGL/ODF), to promote survival of dendritic cells and differentiation of osteoclasts. Although RANK is widely expressed, its cell surface expression may be more restricted to dendritic cells and foreskin fibroblasts. RANK contains a 383-amino acid intracellular domain that associates with specific members of the TRAF family to NF-kappaB and JNK activiation. RANKL/RANK signaling may also lead to survival signaling through activation of the Akt pathway and an upregulation of survival proteins, including Bcl-xL. RANK signaling has been implicated as a potential therapeutic to inhibit bone loss and arthritis.
Molekulargewicht: ~21kDa
Tag: His-tag
UniProt: Q9Y6Q6
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP