CD265 Recombinant Protein, E. coli

Catalog Number: BWT-NCP0359
Article Name: CD265 Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0359
Supplier Catalog Number: NCP0359
Alternative Catalog Number: BWT-NCP0359-500UG,BWT-NCP0359-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
RANK (receptor activator of NF-kappaB) is a member of the tumor necrosis factor (TNF) receptor subfamily that is activated by its ligand, RANKL (TRANCE/OPGL/ODF), to promote survival of dendritic cells and differentiation of osteoclasts. Although RANK is widely expressed, its cell surface expression may be more restricted to dendritic cells and foreskin fibroblasts. RANK contains a 383-amino acid intracellular domain that associates with specific members of the TRAF family to NF-kappaB and JNK activiation. RANKL/RANK signaling may also lead to survival signaling through activation of the Akt pathway and an upregulation of survival proteins, including Bcl-xL. RANK signaling has been implicated as a potential therapeutic to inhibit bone loss and arthritis.
Molecular Weight: ~21kDa
Tag: His-tag
UniProt: Q9Y6Q6
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP