Streptavidin Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0373
Artikelname: Streptavidin Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0373
Hersteller Artikelnummer: NCP0373
Alternativnummer: BWT-NCP0373-500UG,BWT-NCP0373-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).
Molekulargewicht: ~38kDa
Tag: His-tag
UniProt: P22629
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ