Streptavidin Recombinant Protein, E. coli

Catalog Number: BWT-NCP0373
Article Name: Streptavidin Recombinant Protein, E. coli
Biozol Catalog Number: BWT-NCP0373
Supplier Catalog Number: NCP0373
Alternative Catalog Number: BWT-NCP0373-500UG,BWT-NCP0373-1MG
Manufacturer: Bioworld Technology
Host: E. coli
Category: Proteine/Peptide
The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin).
Molecular Weight: ~38kDa
Tag: His-tag
UniProt: P22629
Buffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequence: MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ