CD312 Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0404
Artikelname: CD312 Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0404
Hersteller Artikelnummer: NCP0404
Alternativnummer: BWT-NCP0404-500UG,BWT-NCP0404-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
Cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains and promotes cell attachment. Promotes granulocyte chemotaxis, degranulation and adhesion. In macrophages, promotes the release of inflammatory cytokines, including IL8 and TNF. Signals probably through G-proteins. Is a regulator of mast cell degranulation.
Molekulargewicht: ~55kDa
Tag: His-tag
UniProt: Q9UHX3
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTL