CD312 Recombinant Protein, E. coli

Product Overview

• Article Name: CD312 Recombinant Protein, E. coli
• Biozol Catalog Number: BWT-NCP0404
• Supplier Catalog Number: NCP0404
• Alternative Catalog Number: BWT-NCP0404-500UG,BWT-NCP0404-1MG
• Manufacturer: Bioworld Technology
• Host: E. coli
• Category: Proteine/Peptide

Product Description

Cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains and promotes cell attachment. Promotes granulocyte chemotaxis, degranulation and adhesion. In macrophages, promotes the release of inflammatory cytokines, including IL8 and TNF. Signals probably through G-proteins. Is a regulator of mast cell degranulation.

Product Properties

• Molecular Weight: ~55kDa
• Tag: His-tag
• UniProt: Q9UHX3
• Buffer: PBS, 4M Urea, PH7.4
• Expression System: pet-22b(+)
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Sequence: QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTL