Recombinant Human Brain Natriuretic Peptide (rHuBNP )

Produktübersicht

• Artikelname: Recombinant Human Brain Natriuretic Peptide (rHuBNP )
• Artikelnummer: BWT-PR1011
• Hersteller Artikelnummer: PR1011
• Alternativnummer: BWT-PR1011-20UG,BWT-PR1011-100UG,BWT-PR1011-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeosta

Produkteigenschaften

• Molekulargewicht: 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
• Quelle: Escherichia coli.
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Formel: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio