Recombinant Human Brain Natriuretic Peptide (rHuBNP )

Catalog Number: BWT-PR1011
Article Name: Recombinant Human Brain Natriuretic Peptide (rHuBNP )
Biozol Catalog Number: BWT-PR1011
Supplier Catalog Number: PR1011
Alternative Catalog Number: BWT-PR1011-20UG,BWT-PR1011-100UG,BWT-PR1011-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeosta
Molecular Weight: 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Formula: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio