Recombinant Human ErbB3 Fragment (rHu ErbB3-f)

Produktübersicht

• Artikelname: Recombinant Human ErbB3 Fragment (rHu ErbB3-f)
• Artikelnummer: BWT-PR1023
• Hersteller Artikelnummer: PR1023
• Alternativnummer: BWT-PR1023-5UG,BWT-PR1023-20UG,BWT-PR1023-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Biochemikalien

Produktbeschreibung

ErbB3, also called Her3 (human epidermal growth factor receptor 3), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of

Produkteigenschaften

• Molekulargewicht: Approximately 34 kDa, a single non-glycosylated fusion polypeptide chain, containing 171 amino acids (Ser20- Cys190) with N-terminus Thioredoxin Tag and His tag.
• Quelle: Escherichia coli.
• Reinheit: >95% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHP DLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYN TNSSHALRQ
• Formel: A white, semitransparent suspension, the normal content of each vial is 1 mg of rhErbB3-f, 1mg aluminum hydroxide and small amount of arginine, sodium chloride, sodium phosphate, and potassium phosphate.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportio