Recombinant Human ErbB3 Fragment (rHu ErbB3-f)

Catalog Number: BWT-PR1023
Article Name: Recombinant Human ErbB3 Fragment (rHu ErbB3-f)
Biozol Catalog Number: BWT-PR1023
Supplier Catalog Number: PR1023
Alternative Catalog Number: BWT-PR1023-5UG,BWT-PR1023-20UG,BWT-PR1023-1.0MG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
ErbB3, also called Her3 (human epidermal growth factor receptor 3), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of growth factors. Among ErbB family members, ErbB3 is unique in that it contains a defective kinase domain. ErbB3 is expressed in keratinocytes, melanocytes, skeletal muscle cells, embryonic myoblasts and Schwann cells. Monomeric ErbB3 serves as a low affinity receptor for the heregulins (HRG). rhErbB3-f is a recombinant genetic engineering product which expressed in E. Coli. RhErbB3-f can induce specific antibody production in vivo, hence to inhibit tumor cell growth. The product can be used to treat early, medium and advanced or post-operative breast cancer patients with over-expression of ErbB2. According to its mechanism of action, rhErbB3-f is classified into therapeutic cancer vaccine.
Molecular Weight: Approximately 34 kDa, a single non-glycosylated fusion polypeptide chain, containing 171 amino acids (Ser20- Cys190) with N-terminus Thioredoxin Tag and His tag.
Source: Escherichia coli.
Purity: >95% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHP DLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYN TNSSHALRQL
Formula: A white, semitransparent suspension, the normal content of each vial is 1 mg of rhErbB3-f, 1mg aluminum hydroxide and small amount of arginine, sodium chloride, sodium phosphate, and potassium phosphate.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.