Bacterial porB protein

Produktübersicht

• Artikelname: Bacterial porB protein
• Artikelnummer: BYT-ORB10002
• Hersteller Artikelnummer: orb10002
• Alternativnummer: BYT-ORB10002-1, BYT-ORB10002-100, BYT-ORB10002-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Class 3 protein Porin

Produktbeschreibung

This Bacterial porB protein spans the amino acid sequence from region 20-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 49.8 kDa
• UniProt: E6MZM0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 20-331aaSequence Info: Full Length of MatureProtein Glycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.