Bacterial porB protein

Artikelnummer: BYT-ORB10002
Artikelname: Bacterial porB protein
Artikelnummer: BYT-ORB10002
Hersteller Artikelnummer: orb10002
Alternativnummer: BYT-ORB10002-1,BYT-ORB10002-100,BYT-ORB10002-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Alternative Synonym: Class 3 protein Porin
Recombinant of bacterial porB protein
Molekulargewicht: 49.8 kDa
UniProt: E6MZM0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFK
Anwendungsbeschreibung: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 20-331aaSequence Info: Full Length of MatureProtein Glycerol content: 0.5