Bacterial porB protein

Catalog Number: BYT-ORB10002
Article Name: Bacterial porB protein
Biozol Catalog Number: BYT-ORB10002
Supplier Catalog Number: orb10002
Alternative Catalog Number: BYT-ORB10002-1,BYT-ORB10002-100,BYT-ORB10002-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Bacteria
Alternative Names: Class 3 protein Porin
Recombinant of bacterial porB protein
Molecular Weight: 49.8 kDa
UniProt: E6MZM0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFK
Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 20-331aaSequence Info: Full Length of MatureProtein Glycerol content: 0.5