Human FOxM1 protein

Artikelnummer: BYT-ORB10024
Artikelname: Human FOxM1 protein
Artikelnummer: BYT-ORB10024
Hersteller Artikelnummer: orb10024
Alternativnummer: BYT-ORB10024-1,BYT-ORB10024-100,BYT-ORB10024-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11
Recombinant of human FOxM1 protein
Molekulargewicht: 31.2 kDa
UniProt: Q08050
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Anwendungsbeschreibung: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 235-327aaSequence Info: PartialGlycerol content: 0.5