Human FOxM1 protein

Catalog Number: BYT-ORB10024
Article Name: Human FOxM1 protein
Biozol Catalog Number: BYT-ORB10024
Supplier Catalog Number: orb10024
Alternative Catalog Number: BYT-ORB10024-1,BYT-ORB10024-100,BYT-ORB10024-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11
Recombinant of human FOxM1 protein
Molecular Weight: 31.2 kDa
UniProt: Q08050
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 235-327aaSequence Info: PartialGlycerol content: 0.5