Human FBP1 protein

Produktübersicht

• Artikelname: Human FBP1 protein
• Artikelnummer: BYT-ORB10080
• Hersteller Artikelnummer: orb10080
• Alternativnummer: BYT-ORB10080-1, BYT-ORB10080-100, BYT-ORB10080-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: D-fructose-1,6-bisphosphate 1-phosphohydrolase 1 Liver FBPase

Produktbeschreibung

This Human FBP1 protein spans the amino acid sequence from region 2-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.7 kDa
• UniProt: P09467
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-3398aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.