Human FBP1 protein

Product Overview

• Article Name: Human FBP1 protein
• Biozol Catalog Number: BYT-ORB10080
• Supplier Catalog Number: orb10080
• Alternative Catalog Number: BYT-ORB10080-1,BYT-ORB10080-100,BYT-ORB10080-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: D-fructose-1,6-bisphosphate 1-phosphohydrolase 1 Liver FBPase

Product Description

Recombinant of human FBP1 protein

Product Properties

• Molecular Weight: 56.7 kDa
• UniProt: P09467
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHR

Application Notes

• Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-3398aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5